Protein Info for ABID97_RS11780 in Variovorax sp. OAS795

Annotation: TRAP transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 transmembrane" amino acids 33 to 58 (26 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 211 to 242 (32 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 373 to 399 (27 residues), see Phobius details amino acids 420 to 438 (19 residues), see Phobius details amino acids 444 to 464 (21 residues), see Phobius details amino acids 476 to 500 (25 residues), see Phobius details amino acids 520 to 552 (33 residues), see Phobius details amino acids 564 to 584 (21 residues), see Phobius details amino acids 604 to 625 (22 residues), see Phobius details PF04290: DctQ" amino acids 49 to 175 (127 residues), 99.2 bits, see alignment E=1.8e-32 PF06808: DctM" amino acids 215 to 624 (410 residues), 351.5 bits, see alignment E=6.1e-109 TIGR00786: TRAP transporter, DctM subunit" amino acids 225 to 626 (402 residues), 292.2 bits, see alignment E=2.9e-91

Best Hits

KEGG orthology group: None (inferred from 96% identity to vpe:Varpa_3884)

Predicted SEED Role

"Predicted gluconate TRAP family transporter, DctM subunit" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (631 amino acids)

>ABID97_RS11780 TRAP transporter large permease subunit (Variovorax sp. OAS795)
MVHESTFEAAPFVGAGPSANALSGMAGRADRVLGGVVEAVAALLVLAEIGVLFAGVVSRY
VFHAPLVWSDELASILFLWLSMLGAVVALRRGEHMRMTALLQKVAPSTRAMLDAFAIAAS
IAFLVLIIWPSIDYAHEESFIVTPALEISNAWRAAAIPAGIGIMVAMALLRLLRVCTGRQ
IAVAVLGMAALVGAFWLAAPLFGALGKFNLVIFFVVVVAATVLSGVPIAFSFALATFGYL
ALTTRTPLLVMVGRLDEGMSHLILLAVPLFIFLGALIEMTGMARAMIQFLASLLGHVRGG
LSYVLIGAMYLVSGISGSKIADMAAIAPVLFPEMVKRGAKPGDLVALLSATGAQTETIPP
SIVLITIGSVTGISIAALFTGGLLPAVVLGAALCVVVWWRYRREDLSGVQRHSKREIGKL
LLVALPAVLLPFVIRAAVVEGVATATEVSTIGIVYSALVGLFVYRQFDWKRLKPMLVDTA
SLSGAIIFIVGCATAMAWGLTQSGFSQDLARVMGALPGGAYGFLAVSIVAFIVLGSVLEG
IPAIVLFGPLLFPIAKAAGVHEVHYAMVVIFAMGIGLFAPPFGVGYYGACAVSKVNPDEG
IRHIWGYIAAMLVGLVIVAAFPWFSTGFLKF