Protein Info for ABID97_RS11510 in Variovorax sp. OAS795

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 142 to 168 (27 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 14 to 276 (263 residues), 112.6 bits, see alignment E=3e-36 PF00005: ABC_tran" amino acids 332 to 488 (157 residues), 68.9 bits, see alignment E=1.1e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (562 amino acids)

>ABID97_RS11510 ATP-binding cassette domain-containing protein (Variovorax sp. OAS795)
MALPFVSNDFVAYQIALFLIYGIATQGVALCWGRLGFLPLGHALFFGLGAYLAGGMLKAA
QQQPAWFAALPLALLAPAALAYVAARLVFARSHRSGPFFSLITLAMTMLGFLAVQQWSAV
TGGFNGMADIPELPGTERYSSFYWVVAACALGSTLLIAGMLGRPLGLLWTALAQNEERLQ
LFGYATDRIKAVAFAFSAMLAALAGALFALHQGIVTPLTMGFVLSTEFVIWAAVGGKASP
LGALLGAVFVGYASSELRDHFAYWEVAVGAIFILVVRFLPDGLAGLGRRFSARAEEIPQA
HKTLAPEVRAQGADVRLAFEQVESAQGGVRILDGLTFDLQGPGLRCVIGPNGAGKTSAFN
VMTGRLPLRAGRIRLDGADVSGATAWRVARQGVGRKLQIPSVFPGLSVSQNLDVALWAGR
LHPAASLQRAPLAWDSPLRGELLALFPALGRQLQAPAGSLSQGERQALEFVMTMLPQPRL
VLLDEPCAGLSPAETHHMIEAIKTATGRLGAAALVIEHDISAVAAIGGDVYVLHQGKLLA
RGPLAQIQADPAVRAVYAGARK