Protein Info for ABID97_RS10980 in Variovorax sp. OAS795

Annotation: alternative ribosome rescue aminoacyl-tRNA hydrolase ArfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF00472: RF-1" amino acids 8 to 130 (123 residues), 80.1 bits, see alignment E=6.4e-27

Best Hits

Swiss-Prot: 66% identical to ARFB_PSEPU: Peptidyl-tRNA hydrolase ArfB (arfB) from Pseudomonas putida

KEGG orthology group: K15034, ribosome-associated protein (inferred from 94% identity to vpe:Varpa_2111)

MetaCyc: 56% identical to peptidyl-tRNA hydrolase, ribosome rescue factor (Escherichia coli K-12 substr. MG1655)
Aminoacyl-tRNA hydrolase. [EC: 3.1.1.29]

Predicted SEED Role

"Hypothetical protein YaeJ with similarity to translation release factor"

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.29

Use Curated BLAST to search for 3.1.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>ABID97_RS10980 alternative ribosome rescue aminoacyl-tRNA hydrolase ArfB (Variovorax sp. OAS795)
MLRPPLLIDPDEVEISAIRAQGAGGQNVNKVSSAVHLRYDIHACSLPADVKERLLALRDS
RITQEGVFVLKAQQHRTQEMNRADALARLQAVVDSVATPPRVRRPTKPTYGSRQRRLEGK
SQRSQIKNLRGPVRD