Protein Info for ABID97_RS10780 in Variovorax sp. OAS795

Annotation: Fe2+-dependent dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13640: 2OG-FeII_Oxy_3
  • amino acids 84 to 177 (94 residues), 49 bits, E=9.6e-17
• PF18331: PKHD_C
  • amino acids 184 to 227 (44 residues), 64.5 bits, 7.3e-22

Best Hits

Swiss-Prot: 90% identical to Y1809_VARPS: PKHD-type hydroxylase Vapar_1809 (Vapar_1809) from Variovorax paradoxus (strain S110)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 90% identity to vap:Vapar_1809)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Diterpenoid biosynthesis
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Protein Sequence (228 amino acids)

>ABID97_RS10780 Fe2+-dependent dioxygenase (Variovorax sp. OAS795)
MLLHIREVLSPDEVRHAREILGQAPWEDGRLTAGEQSAKAKNNEQLREDCEETRAVQQLL
LRGLERHQIFFSAALPKQISPPLFNRYGGTSNSFGNHVDSAVRFLRDGTGRVRTDISCTV
FLAGPDEYDGGELVIEDTFGTQRVKLAAGDMVLYPGTSVHRVLPVTRGFRIASYFWIQSM
VRSDEQRRLLFEMDNHLRHLRSQYGETDPGVIGLTSTYHNLLRMWLDV