Protein Info for ABID97_RS10530 in Variovorax sp. OAS795

Annotation: multidrug effflux MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details amino acids 30 to 34 (5 residues), see Phobius details transmembrane" amino acids 17 to 29 (13 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 314 to 338 (25 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 14 to 391 (378 residues), 267.9 bits, see alignment E=9.9e-84 PF07690: MFS_1" amino acids 21 to 360 (340 residues), 163.1 bits, see alignment E=8.8e-52 PF00083: Sugar_tr" amino acids 51 to 193 (143 residues), 41.6 bits, see alignment E=8.2e-15

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 92% identity to vpe:Varpa_1934)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>ABID97_RS10530 multidrug effflux MFS transporter (Variovorax sp. OAS795)
MNPDAAKLWQAPRWALAVLLAVLGMLGPFSIDTYIPAFSGIARSIGATPAEMQQTLSAYL
FGFAFMNLFHGALSDSFGRRPVVLWGLAVFTLASLGCALSQNIAQLVLFRGLQGLSTGAG
IVVSRAVIRDMFPPADAQRVMSQVTIYFGVAPAIAPIVGGFLFVHAGWHAIFWFLVAVGV
ILFVANYKLLPETLHQSQRQPFQVRHLMRGYWDLCSDPRFLLLAFASGVPFNGMFLYVLA
APAFLGDHLALAPTQFFWFFLLTIGGIMSGAWASGRMAGKVAPKRQIRDGFLIMLVTSLV
NVVANWLFTAHAVWALWPLAVFAFGWALMVPVVTLLVLDLHPERRGMASSLQAVIGSTAN
GVVAGVVAPLVMHSTLALALTSTLMLGIGLVAWVWLHGQWPEIGRRVAAEA