Protein Info for ABID97_RS10525 in Variovorax sp. OAS795

Annotation: HPP family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details PF04982: HPP" amino acids 57 to 173 (117 residues), 126.2 bits, see alignment E=8.4e-41 PF00571: CBS" amino acids 230 to 283 (54 residues), 50.3 bits, see alignment 2.4e-17 amino acids 313 to 368 (56 residues), 43.3 bits, see alignment 3.7e-15

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 87% identity to vap:Vapar_1760)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>ABID97_RS10525 HPP family protein (Variovorax sp. OAS795)
MPQLSALLTHARAWLPGRNTVDARERMRAVAGAAIGLLITALLCRWMAQAVDVSIWLIAP
MGASAVLVFAVPASPLAQPWSVVVGNTLSTLVGIACIRWIPDPAWAAAIAVGGAIGLMFA
TRSLHPPGGAAALLAVLTHTDHFSAALFPTFTNSLLLVLAGVAYNSFTGRRYPHVVRPPP
ADARFSQADIDAVLARYNQVLDISRDDLESLIQQTELESYKRRLGTLHCSDIMSREPVSV
EFGTPLQEAWMLMNQRRIKALPVIDRTRRVVGIVTQADFFRLLDLEHHEGIAGRLRDLIR
ATRTVVSNKPEVVGQIMTRQVRVASADRPVVDLVPLFSEGGHHHIPIIDHEKRLTGMITQ
SDFVRALYSAVRP