Protein Info for ABID97_RS10480 in Variovorax sp. OAS795

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00005: ABC_tran" amino acids 22 to 177 (156 residues), 106.7 bits, see alignment E=2.3e-34 PF12399: BCA_ABC_TP_C" amino acids 225 to 249 (25 residues), 32 bits, see alignment (E = 1.1e-11)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 95% identity to vap:Vapar_1750)

Predicted SEED Role

"Benzoate transport, ATPase component" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>ABID97_RS10480 ABC transporter ATP-binding protein (Variovorax sp. OAS795)
MTETVLSTQGLVMRFGGITATNDVTMELKRGARHALIGPNGAGKTTLINLLTGVLTPTSG
RISLLGEDITTLAPHKRVARGLVRTFQINQLFDSMTPLETLALVVSQHQGIASQWWRPLG
ATQAVTERAAELLEQFHLGDVAQQQTKFMAYGKRRLLEIAIALACEPRVLLLDEPVAGVP
AGEREELLETVAALPADVSVLLIEHDMDLVFSFADRMTVLVNGTLLTEGDPETIAADPKV
KEVYLGHGEHAHV