Protein Info for ABID97_RS10475 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 208 to 237 (30 residues), see Phobius details amino acids 256 to 281 (26 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 304 (262 residues), 115.3 bits, see alignment E=1.4e-37

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 94% identity to vap:Vapar_1749)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ABID97_RS10475 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MSAPSSYESALLRKARWRPLEFVVWAAAFALPFVMPSHSLLVNEIAIVALFAMSLDLILG
YTGIVSLGHAAFFGFGAYTAALFAKLVMPDPTVGLVVATVLSALLGLLASVTILRGSDLT
RLMVTLGTALLLLELANKLDWLTGGADGLQGVVMGPVLGLFEFDLFGRTAAWYSLSVMLV
LFLVMRRLVHSPFGATLKAIRDNRLRAMAIGIPVVSRLVVIYTVAAGIAGAAGALLAQTT
GFASLDVLAFDRSADVLLMLVIGGVGWLYGGVAGAIVFKLLQNWLSAVTPQYWMFWIGLL
LVLLVLVGRDRVLKPWTWLGKRKGSRA