Protein Info for ABID97_RS10395 in Variovorax sp. OAS795

Annotation: glycine betaine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 319 to 342 (24 residues), see Phobius details amino acids 353 to 391 (39 residues), see Phobius details amino acids 425 to 457 (33 residues), see Phobius details amino acids 476 to 498 (23 residues), see Phobius details PF04069: OpuAC" amino acids 32 to 288 (257 residues), 180.9 bits, see alignment E=3.6e-57 PF00528: BPD_transp_1" amino acids 329 to 500 (172 residues), 77.2 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 92% identity to vap:Vapar_1735)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1) / Osmotic adaptation" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>ABID97_RS10395 glycine betaine ABC transporter substrate-binding protein (Variovorax sp. OAS795)
MHLPHRILRSALLLLTLAWLGAAASAQPGEGTLRVGSKRFTESYILAELLAQTAAPHTPS
PPVLRQGLGNTAIVYEALRSGAIDLYAEYTGTIALEILKGSPAETREAMNAALAPLGLGV
AIPLGFNDGYALAVRAADAERLGLRTLSDLARHPELKLGLSNEFIGRADGWKGLAARYGF
TQAPTGLDHGLAYEAMAAKQIDAIDIYTTDAKIDHLGLRVLEDDRKYFPRYDAVVLYRLD
LPARLPKAWAALQALEGRIDEKAMIAMNARAELQSVPFDAIARDFLANAGGKAQPREPRR
GFAAKLFGPDLWQLARQHLLLVVVSVGIAILLGVPLAILVFAHVRLRALVLGIASILQTV
PSLALLAVLISLLGAIGALPALIALTLYSLLPIMRNTVTGLAEVPNGLRMAGTALGMTPP
QSLRLVLLPLALPTLLAGVRTATAIAIGTATIAAFIGAGGFGERIVTGLALNDRELLLAG
ALPAAALALLSEGIFELLEMLLRRRRTAPPSALPQ