Protein Info for ABID97_RS10380 in Variovorax sp. OAS795
Annotation: aldehyde dehydrogenase family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 38% identical to BETB_PARPJ: NAD/NADP-dependent betaine aldehyde dehydrogenase (betB) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
KEGG orthology group: K00128, aldehyde dehydrogenase (NAD+) [EC: 1.2.1.3] (inferred from 95% identity to vap:Vapar_1732)MetaCyc: 57% identical to 2,5-dioxovalerate dehydrogenase (Caulobacter vibrioides CB15)
2,5-dioxovalerate dehydrogenase. [EC: 1.2.1.26]
Predicted SEED Role
"2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26)" in subsystem L-Arabinose utilization or Xylose utilization (EC 1.2.1.26)
MetaCyc Pathways
- D-galactarate degradation II (3/3 steps found)
- D-glucarate degradation II (3/3 steps found)
- L-lyxonate degradation (3/3 steps found)
- ethanol degradation II (3/3 steps found)
- ethanol degradation IV (3/3 steps found)
- L-arabinose degradation III (5/6 steps found)
- D-glucuronate degradation II (4/5 steps found)
- octane oxidation (4/5 steps found)
- phytol degradation (3/4 steps found)
- ethanol degradation III (2/3 steps found)
- hypotaurine degradation (2/3 steps found)
- D-galacturonate degradation II (3/5 steps found)
- mitochondrial NADPH production (yeast) (3/5 steps found)
- superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
- fatty acid α-oxidation I (plants) (2/4 steps found)
- histamine degradation (1/3 steps found)
- 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
- D-arabinose degradation III (3/6 steps found)
- D-xylose degradation III (2/5 steps found)
- D-xylose degradation V (2/5 steps found)
- trans-4-hydroxy-L-proline degradation II (1/4 steps found)
- L-tryptophan degradation X (mammalian, via tryptamine) (1/4 steps found)
- putrescine degradation III (1/4 steps found)
- serotonin degradation (3/7 steps found)
- dopamine degradation (1/5 steps found)
- ceramide degradation by α-oxidation (2/7 steps found)
- limonene degradation IV (anaerobic) (2/7 steps found)
- sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
- alkane oxidation (1/6 steps found)
- aromatic biogenic amine degradation (bacteria) (1/8 steps found)
- noradrenaline and adrenaline degradation (4/13 steps found)
- ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
- superpathway of microbial D-galacturonate and D-glucuronate degradation (13/31 steps found)
- superpathway of pentose and pentitol degradation (15/42 steps found)
KEGG Metabolic Maps
- 1,2-Dichloroethane degradation
- 3-Chloroacrylic acid degradation
- Arginine and proline metabolism
- Ascorbate and aldarate metabolism
- Butanoate metabolism
- Fatty acid metabolism
- Glycerolipid metabolism
- Glycolysis / Gluconeogenesis
- Histidine metabolism
- Limonene and pinene degradation
- Lysine degradation
- Propanoate metabolism
- Pyruvate metabolism
- Tryptophan metabolism
- Urea cycle and metabolism of amino groups
- Valine, leucine and isoleucine degradation
- beta-Alanine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.2.1.26, 1.2.1.3
Use Curated BLAST to search for 1.2.1.26 or 1.2.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (478 amino acids)
>ABID97_RS10380 aldehyde dehydrogenase family protein (Variovorax sp. OAS795) MQNHDNLINGEWRAGASYSPNVNPSNLGDVLGHYAQGSAADVQAAVAAATAAFPAWATGS IQARSDALDKIGTEILARKEELGTLLAREEGKTRAEGIGEATRAGQIFKFFAGECLRLSG ELLPSVRPHIGVEITREPVGVVGLITPWNFPIAIPAWKIAPALAFGNCVVLKPADLVPGC AWALSEIIHRSGIPAGVFNLVMGRGSVIGNALVEHPGIHAISFTGSVGVGRNIAVQCVTN HKKVQLEMGGKNPQVILDDADLAQAVELSVQSAFYSTGQRCTASSRLIVTEGIYPKFIEA MKTRMARIKVGDALAQGTDIGPVSSRSQLDQDLEYVAIGRGEGATLAAGGELLKLETDGY YMSPALFSESAAAMRINKEEIFGPVASVIRVKDYEEALATANDTEFGLSAGIATTSLKHA THFKRHSQAGMVMVNLPTAGVDYHVPFGGRKGSSYGPREQGKYAQEFFTTVKTAYTLA