Protein Info for ABID97_RS10375 in Variovorax sp. OAS795

Annotation: glucarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR03247: glucarate dehydratase" amino acids 14 to 452 (439 residues), 870.8 bits, see alignment E=8.6e-267 PF02746: MR_MLE_N" amino acids 51 to 144 (94 residues), 24.3 bits, see alignment E=3.2e-09 PF13378: MR_MLE_C" amino acids 195 to 411 (217 residues), 156.7 bits, see alignment E=7.4e-50

Best Hits

Swiss-Prot: 75% identical to GUDD_PSEPU: Glucarate dehydratase (gudD) from Pseudomonas putida

KEGG orthology group: K01706, glucarate dehydratase [EC: 4.2.1.40] (inferred from 97% identity to vap:Vapar_1731)

MetaCyc: 75% identical to D-glucarate dehydratase subunit (Pseudomonas putida)
Glucarate dehydratase. [EC: 4.2.1.40]

Predicted SEED Role

"Glucarate dehydratase (EC 4.2.1.40)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>ABID97_RS10375 glucarate dehydratase (Variovorax sp. OAS795)
MTLSSASTSSVSGAPVVTGMRVVPVAGHDSMLMNLSGAHGPFFTRNLLILTDSAGHTGVG
EVPGGEKIRQTLEDARDLIVGQPLGKHHAVLNSMRSAFANRDSGGRGQQTFDLRVTIHAV
TAVEAALLDLLGQHLEVPVAALLGEGQQRDAVQMLGYLFYVGDRNKTDLPYETDPGADND
WFRLRHEEAMTPEAIVRLAEATHARYGFTDFKLKGGVLRGEEEVEAIRALHERFPDARVT
LDPNGGWLLADAIRLCRDLHGVMAYAEDPCGAEGVFSGREVMAEFRRATGLPTATNMVAT
DWREMVHSLSLQSVDIPLADPHFWTMQGSVRVAQLCQAWGLTWGSHSNNHFDVSLAMFTH
VAAAAPGKVTAIDTHWIWQDGQRLTKAPLQIEGGYVKVPTRGGLGVELDMDEVEKAHQLY
LKHGLGARNDAQAMQYLIPGWTFDNKKPCMVR