Protein Info for ABID97_RS10350 in Variovorax sp. OAS795

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF04321: RmlD_sub_bind" amino acids 14 to 163 (150 residues), 31.3 bits, see alignment E=3.5e-11 PF01370: Epimerase" amino acids 15 to 175 (161 residues), 79.2 bits, see alignment E=9.9e-26 PF01073: 3Beta_HSD" amino acids 17 to 132 (116 residues), 40.2 bits, see alignment E=6.7e-14 PF13460: NAD_binding_10" amino acids 19 to 124 (106 residues), 34.6 bits, see alignment E=5.5e-12 PF16363: GDP_Man_Dehyd" amino acids 45 to 172 (128 residues), 47.2 bits, see alignment E=6.9e-16 PF07993: NAD_binding_4" amino acids 65 to 200 (136 residues), 30 bits, see alignment E=8.9e-11

Best Hits

Swiss-Prot: 75% identical to URODH_PSESM: Uronate dehydrogenase (udh) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 91% identity to vap:Vapar_1726)

MetaCyc: 75% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>ABID97_RS10350 NAD(P)-dependent oxidoreductase (Variovorax sp. OAS795)
MSTTPQASHNKLHRILLTGAAGGLGKVLRERLRPYAAILRLSDIAALAPSEGAHEEVVPC
NLSDKAAVHALVEGCDAIVHLGGVSVERPFEEILEANIKGVFHIYEAARRHGVKRVVFAS
SNHVIGFYKQDERLDAAVPRRPDGYYGLSKSFGEDVAQFYYDRYGIETVSIRIGSSFPEP
LNRRMMSTWLSYRDLTTLMEKSIFTPDVKHTVVYGMSANRDLWWDNSAAAHLGFVPQDSS
EVFRDKVEAQPPVAPTDPNAIYQGGAFTAQGPFGDQ