Protein Info for ABID97_RS10190 in Variovorax sp. OAS795

Annotation: decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 TIGR00873: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 7 to 470 (464 residues), 711.7 bits, see alignment E=2.1e-218 PF03446: NAD_binding_2" amino acids 8 to 174 (167 residues), 168.2 bits, see alignment E=1.6e-53 PF00393: 6PGD" amino acids 180 to 469 (290 residues), 423.4 bits, see alignment E=4.7e-131

Best Hits

Swiss-Prot: 59% identical to 6PGD_BACSU: 6-phosphogluconate dehydrogenase, NADP(+)-dependent, decarboxylating (gndA) from Bacillus subtilis (strain 168)

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 95% identity to vap:Vapar_1694)

MetaCyc: 59% identical to 6-phosphogluconate dehydrogenase (decarboxylating) (Bacillus subtilis)
Phosphogluconate dehydrogenase (decarboxylating). [EC: 1.1.1.44]

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>ABID97_RS10190 decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase (Variovorax sp. OAS795)
MSNDKSDFGLIGLAVMGQNLVLNVESRGFQVSVYNRTEATTEAFLAENPGKKLVGATTLE
EFVQSLARPRKIQIMVKAGAPVDQVIEQLIPLLDKDDIVIDGGNSLYTDTERRDAYLAGK
GLRFIGAGVSGGEEGARKGPSIMPGGPLSTWEVMKPIFESIAAKVDGEPCVIHIGPGGAG
HFVKMVHNGIEYGDMQLICEAYSLFKAAGFSTDETASVFNEWNEGELQSYLIQITAKALE
QKDPETGKPIVELILDKAGQKGTGQWTLMNAAENAVVISTINAAVEARVLSSQKKARVAA
SKVLQGPKIELSLDKKALVAKVHDALYASKVISYTQGFDLIQTMGEKKGWKLDLSGIASI
WRGGCIIRARFLNRITDAYRTDPALGNLMLDPFFKDLLNRTQQSWREVVALAVGNGIPVP
AFSASLAYYDSYRTERLPANLLQAQRDFFGAHTYERTDKPEGQFFHTHWPEVIG