Protein Info for ABID97_RS10170 in Variovorax sp. OAS795

Annotation: efflux transporter outer membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 2 to 454 (453 residues), 398.6 bits, see alignment E=1.9e-123 PF02321: OEP" amino acids 52 to 246 (195 residues), 68.9 bits, see alignment E=2.6e-23 amino acids 272 to 444 (173 residues), 96 bits, see alignment E=1.3e-31

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_1854)

Predicted SEED Role

"Heavy metal RND efflux outer membrane protein, CzcC family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>ABID97_RS10170 efflux transporter outer membrane subunit (Variovorax sp. OAS795)
MLAAGCAVGPDYKAPATPLPVSWKLEAPWRQAAPDDSADKGPWWKRFGDAQLDALQEQAL
AGSPTLAVANARLAQARATVSASSASQFPQLGLGTRASRLKISANRPLTNYATANSSTVQ
NDFALSLNASYELDLAGRVQRSVEGATASAEQSAADLENTRLVLTADVANNYFNLRSTDI
ELDVLSRSIALQRRALELVTARHELGAVSGLDVAQQQALLDTTLTQVDVLKKQRAQYEHA
LATLTGTPAPSFALAADLREIRPPAVPLGVPSEMLQRRPDVASAERAMAAANAQIGVATA
AFYPSFIISPTVGVDSRMIETLFNGPSLLWSVGVSATQVLFDGGRVRANVDFAKAGYDAT
VGNYRRTVLTAMQEVEDGITGLAALDRATTQAQAAVGAARRVLDMATSRYEGGASTYLDV
ITAQQSLLTVERQASQLQGQRLLTSVFLVKALGGDWCGAGASTPSDPRTGCPAPMRQAAG
TR