Protein Info for ABID97_RS10070 in Variovorax sp. OAS795

Annotation: YihY family inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 39 to 67 (29 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 211 to 237 (27 residues), see Phobius details amino acids 244 to 276 (33 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 26 to 276 (251 residues), 196.1 bits, see alignment E=5e-62 PF03631: Virul_fac_BrkB" amino acids 32 to 276 (245 residues), 180 bits, see alignment E=3.5e-57

Best Hits

Swiss-Prot: 61% identical to Y2991_RHOFT: UPF0761 membrane protein Rfer_2991 (Rfer_2991) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K07058, membrane protein (inferred from 96% identity to vap:Vapar_1670)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>ABID97_RS10070 YihY family inner membrane protein (Variovorax sp. OAS795)
MIPAMNRQQLWRDLSRFPWGDTAAVLGERFREDRLGLTASSLTFTTTIAMVPFFTVALAL
FTVFPMFAKLQGGLQRWLIESLIPDNIARQVLGYLNQFSSKAGGLGIAGLVVLLITAIAL
ILTIDKTLNNIWRVRSPRPFAQRVLIYWAAITLGPLILGVSLSTTSYVFAASRDVVGGSI
LKLFFDTFEIVLLAGGMASLYHYVPNTNVRWAHAWAGGIFVAAAIEIAKRVLGYYLSLVP
TYSVLYGAFATVPILLIWIYVAWVIVLLGAVIAAYLPSLLTGVARRGGRAGWPLQLAMEV
LQHLARARATPAKGMGAAELVTRMRVDTLQLVPVLETLVAIDWIAPLAEETDDEDPRYVL
LADPSTPIEPLLRELLMPRAEPLEDLWQKGPLHSLRLGDVLLI