Protein Info for ABID97_RS10065 in Variovorax sp. OAS795

Annotation: DUF2069 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details PF09842: DUF2069" amino acids 18 to 120 (103 residues), 119.6 bits, see alignment E=3e-39

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_1669)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>ABID97_RS10065 DUF2069 domain-containing protein (Variovorax sp. OAS795)
MQTITPHASSSVSATRWLAVGSLVGLIVLGLAWELWLAPLRPGGSLLALKVLPLVIPLAG
LYKNRMYTYRWVSLMIWLYFTEGVVRAWSDTNGVGQLLALAEVLLCLALFTACAMHVRLR
LRNAKAARQLEASTQ