Protein Info for ABID97_RS10045 in Variovorax sp. OAS795

Annotation: nitrile hydratase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02979: NHase_alpha
  • amino acids 19 to 200 (182 residues), 296.6 bits, E=2.7e-93
• TIGR01323: nitrile hydratase, alpha subunit
  • amino acids 20 to 205 (186 residues), 308.6 bits, E=6.6e-97

Best Hits

Swiss-Prot: 61% identical to NHAA_PSEPU: Nitrile hydratase subunit alpha (nthA) from Pseudomonas putida

KEGG orthology group: K01721, nitrile hydratase [EC: 4.2.1.84] (inferred from 91% identity to vpe:Varpa_1815)

MetaCyc: 57% identical to nitrile hydratase alpha subunit (Rhodococcus rhodochrous)
Nitrile hydratase. [EC: 4.2.1.84]

Predicted SEED Role

"Cobalt-containing nitrile hydratase subunit alpha (EC 4.2.1.84)" (EC 4.2.1.84)

MetaCyc Pathways

• aldoxime degradation (3/3 steps found)
• superpathway of acrylonitrile degradation (3/3 steps found)
• acrylonitrile degradation I (2/2 steps found)
• indole-3-acetate biosynthesis IV (bacteria) (2/2 steps found)
• indole-3-acetate biosynthesis II (5/12 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via CoA ligation
• Cyanoamino acid metabolism
• Styrene degradation
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.84

Use Curated BLAST to search for 4.2.1.84

Protein Sequence (212 amino acids)

>ABID97_RS10045 nitrile hydratase subunit alpha (Variovorax sp. OAS795)
MTGHDHSHEHSDDHSELGEMDLRVRALESVLTQKGYIDPAALDALIDTYQTRIGPRNGAR
VVARAWVDQTFHDWLMADATAAIASLGYTGRQGEHMVAVENTDDQHHMVVCTLCSCYPWP
VLGLPPTWYKSAPYRSRAVKDPRGVLADFGTALPESTRIRVWDSTAEVRYLVIPQRPAGT
EAWSEDELATLVSRDSMIGTRLADAPTARSVA