Protein Info for ABID97_RS10000 in Variovorax sp. OAS795

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 38 to 53 (16 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 9 to 296 (288 residues), 141.5 bits, see alignment E=1.6e-45 PF01545: Cation_efflux" amino acids 11 to 212 (202 residues), 129 bits, see alignment E=1.1e-41

Best Hits

KEGG orthology group: None (inferred from 89% identity to vap:Vapar_1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>ABID97_RS10000 cation diffusion facilitator family transporter (Variovorax sp. OAS795)
MAESKLAIYGAIAANVAIAATKFVVAGITGSSAMLSEGIHSAVDTFNGVLLLVGIRLSQR
PATAEHPFGHGKELYFWSLIVAVLIFGLGGGVSFYEGIQHMRHPEPMQDPTWNYVVLALA
ALFEGASFLVALRQFRAQARGAPFWRALEQSKDPTTYTVLAEDSAALAGLAVAALGIYLS
HRFDLPALDGAASVVIGLLLAGVAVLLISQARGLLIGEGIRPETARAIRSLAMAQPSVRD
VGHVLSMYMGPDEVLVIVDLNFKEGTATGDAAEAIGAIERQVRARFPMIRRLFIEASEAP
VDGSVPAFGRVGVR