Protein Info for ABID97_RS09575 in Variovorax sp. OAS795

Annotation: ribonuclease H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF00075: RNase_H" amino acids 3 to 143 (141 residues), 106.4 bits, see alignment E=7.1e-35

Best Hits

Swiss-Prot: 49% identical to RNH_HYPNA: Ribonuclease H (rnhA) from Hyphomonas neptunium (strain ATCC 15444)

KEGG orthology group: K03469, ribonuclease HI [EC: 3.1.26.4] (inferred from 49% identity to hne:HNE_0945)

MetaCyc: 41% identical to ribonuclease HI (Escherichia coli K-12 substr. MG1655)
Ribonuclease H. [EC: 3.1.26.4]

Predicted SEED Role

"Ribonuclease HI (EC 3.1.26.4)" in subsystem Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>ABID97_RS09575 ribonuclease H (Variovorax sp. OAS795)
MIEIYTDGSCWPNPSAIGGWSFVAFENGREIHTGSGKADTFTSSNRMEQTAMLRALLWLG
DRPAVLHSDSRYVVDGLNLWSAKWQRNGWTRKDKATKKICDVMNADLWQVMVIARQRQHE
VRWIKGHAGHIGNERADGLAEAARMGATA