Protein Info for ABID97_RS09510 in Variovorax sp. OAS795

Annotation: prephenate dehydrogenase/arogenate dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03807: F420_oxidored" amino acids 5 to 95 (91 residues), 33.9 bits, see alignment E=7.9e-12 PF03446: NAD_binding_2" amino acids 5 to 151 (147 residues), 31.7 bits, see alignment E=3.2e-11 PF02153: PDH_N" amino acids 17 to 172 (156 residues), 125.4 bits, see alignment E=2.9e-40 PF20463: PDH_C" amino acids 177 to 271 (95 residues), 82.1 bits, see alignment E=6.3e-27

Best Hits

KEGG orthology group: K04517, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 91% identity to vap:Vapar_1616)

Predicted SEED Role

"Cyclohexadienyl dehydrogenase (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABID97_RS09510 prephenate dehydrogenase/arogenate dehydrogenase family protein (Variovorax sp. OAS795)
MFEQLGLIGCGLMGGSFALALKRARLVKRVVGYSKSPSTTERARQLGVIDVVAPSALLAV
SGSDLVLLAVPVAASEATFKAIRHGIASDTLVMDVGSTKGDVIEAARSGLQDQFSHFVPA
HPIAGKEVSGIEHADASLYTGRKVVLTPVKATLRSNVQRASQVWSGIGAHVVTMTHEEHD
SAFAAVSHLPHLLAFAYINALVAQPQGDRFLGLAGPGFRDFSRIAASDPVMWRDVLLANR
EQVLRQSQAFRQALLELEALMAATDTQALEHAIAAASKVRAGWQPNTDATQDS