Protein Info for ABID97_RS09465 in Variovorax sp. OAS795

Annotation: TRAP transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 7 to 36 (30 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 108 to 120 (13 residues), see Phobius details amino acids 141 to 167 (27 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 321 to 351 (31 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 403 to 429 (27 residues), see Phobius details PF06808: DctM" amino acids 12 to 424 (413 residues), 286.4 bits, see alignment E=1.8e-89 TIGR00786: TRAP transporter, DctM subunit" amino acids 22 to 429 (408 residues), 354 bits, see alignment E=4.8e-110

Best Hits

KEGG orthology group: None (inferred from 87% identity to aav:Aave_3299)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 5"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>ABID97_RS09465 TRAP transporter large permease subunit (Variovorax sp. OAS795)
MFENLWMGALLLAIMMLLLAGGVWIAMTLAIVGWVGQAFFTNTLPGKNLFSAFWESNASW
ELAALPLFIWMGEILFRTKLSEEMFEGLRPWLNRVPGRLMHTTILGCGVFGSVSGSSAAT
CATIAKVALPELKRRGYNEQLAIGSLATAGTLGILIPPSITMVVYAVAADASIIRIFLAG
FLPGFLLMLLFSGYIGWWSLRNPDQVPPADPPTTFMEKIRLSGNLIPCALLIIFIVWVLV
AGWATATECAAFGVLGSLAIAAWGKSLTWKNFKEGIMGATRTSCMIMFILAGAAFLTKTM
AFTGIPRELAEWVDSMHLSPYALIGALVLVYLVLGTALDGISMIVLTSAVVLPMIQKAGF
DLIWFGIFIVLLVEIAEVTPPVGFNLFVLQNMTGKDSNVIAKAAIPFFFCLVLCIVLITL
FPSIVTILPNVVMGVEK