Protein Info for ABID97_RS09445 in Variovorax sp. OAS795

Annotation: monovalent cation/H+ antiporter subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 87 to 97 (11 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 136 to 146 (11 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 421 to 444 (24 residues), see Phobius details amino acids 464 to 484 (21 residues), see Phobius details amino acids 505 to 525 (21 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 148 to 375 (228 residues), 88.2 bits, see alignment E=2.9e-29

Best Hits

KEGG orthology group: K05561, multicomponent K+:H+ antiporter subunit D (inferred from 94% identity to vap:Vapar_1603)

Predicted SEED Role

"Na(+) H(+) antiporter subunit D" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (568 amino acids)

>ABID97_RS09445 monovalent cation/H+ antiporter subunit D (Variovorax sp. OAS795)
MTALLQLLDRLLDFSMPHLVAVPILVPLFTAALMLLLGERRRRTKSALSVASGLVGLLAA
LALLRWVNAPDTGDGPGSIGIYLPGNWQAPFGIVLVADRLSTMMVALTGVVAFAASIYST
SRWDRAGVHFHPLLQLQLMGLNGAFLTGDLFNLFVFFEVMLAASYGLLLHGSGRLRVQAG
LHYIAINLAASSLFLIGAALLYGVTGTLNMADLSLRIAELAPADRGLVHAAAAILATAFF
AKAGAWPLNFWLVPAYSAAVSPVGAVFALLTKLGIYTLLRLWTLLFAPDAGSSAAFGQSA
LIAIGLATLFAGALGIVGTQRLSNLAGFSVLVSAGTLLAAIGLGEPAVWAGALYYLLSST
LAVSAFFLLTDMIERWRNAGQSVAPHEQAGNAPFLAEDLRVLDDVNLDDEAQALYGRAIP
AGVAFLGLSFIGCTLLLAGLPPLSGFVGKFAMLSGAFVTSGTSTAAWIFLALLIASGFLA
LIALSRTGIRHFWTQPHPTMPALPLLEVLPVAGLLAACVALTVWAGPVMRHAFITAEGLH
APAAYRNAVMNARQVPNPVAAPAKGVAP