Protein Info for ABID97_RS09435 in Variovorax sp. OAS795

Annotation: K+/H+ antiporter subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details PF04066: MrpF_PhaF" amino acids 34 to 85 (52 residues), 65.5 bits, see alignment E=2.3e-22

Best Hits

Swiss-Prot: 52% identical to PHAF_RHIME: Probable K(+)/H(+) antiporter subunit F (phaF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05563, multicomponent K+:H+ antiporter subunit F (inferred from 97% identity to vap:Vapar_1601)

Predicted SEED Role

"Na(+) H(+) antiporter subunit F" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (92 amino acids)

>ABID97_RS09435 K+/H+ antiporter subunit F (Variovorax sp. OAS795)
MTPVLFWALKLALLLLAVAMLCALARLLIGPTAQDRVMALDCLYINGMLMMLVLGIVYAS
NVYFEAAMLTALFGFVGSTAMAKFLLRGEVIE