Protein Info for ABID97_RS09370 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 154 to 179 (26 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 44 to 224 (181 residues), 28.6 bits, see alignment E=5.8e-11

Best Hits

Swiss-Prot: 39% identical to TUPB_CAMJE: Tungstate uptake system permease protein TupB (tupB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K05773, putative tungstate transport system permease protein (inferred from 94% identity to vap:Vapar_1588)

Predicted SEED Role

"ABC-type tungstate transport system, permease protein" in subsystem ABC transporter tungstate (TC 3.A.1.6.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>ABID97_RS09370 ABC transporter permease (Variovorax sp. OAS795)
MNTFAQSAVAAWQLLVSGDPVLLAIVGRSLAVSASACALACGLGLLLGAWLGVARFRGRA
ALLTVLNTLLALPSVVVGLVIYLLLSRSGPLGFLGWLFSFKAMVLAQTVLVLPVVTALTR
QTIEDAERAHGEQLRSLGAGPLVRALLLAWDERYALLTVLIAAFGRAVSEVGAVMVVGGN
IDGFTRVMTTAIALETSKGDLPLALALGIVLLGVVLVLNLAIAAVRGWRERIDGGGGEGG
GVAPWRRPEVGP