Protein Info for ABID97_RS09370 in Variovorax sp. OAS795
Annotation: ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 39% identical to TUPB_CAMJE: Tungstate uptake system permease protein TupB (tupB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
KEGG orthology group: K05773, putative tungstate transport system permease protein (inferred from 94% identity to vap:Vapar_1588)Predicted SEED Role
"ABC-type tungstate transport system, permease protein" in subsystem ABC transporter tungstate (TC 3.A.1.6.2)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (252 amino acids)
>ABID97_RS09370 ABC transporter permease (Variovorax sp. OAS795) MNTFAQSAVAAWQLLVSGDPVLLAIVGRSLAVSASACALACGLGLLLGAWLGVARFRGRA ALLTVLNTLLALPSVVVGLVIYLLLSRSGPLGFLGWLFSFKAMVLAQTVLVLPVVTALTR QTIEDAERAHGEQLRSLGAGPLVRALLLAWDERYALLTVLIAAFGRAVSEVGAVMVVGGN IDGFTRVMTTAIALETSKGDLPLALALGIVLLGVVLVLNLAIAAVRGWRERIDGGGGEGG GVAPWRRPEVGP