Protein Info for ABID97_RS09275 in Variovorax sp. OAS795
Annotation: polyprenyl synthetase family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to CRTE_CYAPA: Geranylgeranyl diphosphate synthase (crtE) from Cyanophora paradoxa
KEGG orthology group: K00795, farnesyl diphosphate synthase [EC: 2.5.1.1 2.5.1.10] (inferred from 95% identity to vap:Vapar_1570)Predicted SEED Role
No annotation
MetaCyc Pathways
- polyisoprenoid biosynthesis (E. coli) (5/5 steps found)
- trans, trans-farnesyl diphosphate biosynthesis (2/2 steps found)
- superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
- geranyl diphosphate biosynthesis (1/1 steps found)
- taxadiene biosynthesis (engineered) (9/13 steps found)
- (3R)-linalool biosynthesis (1/2 steps found)
- (3S)-linalool biosynthesis (1/2 steps found)
- linalool biosynthesis I (1/2 steps found)
- all-trans-farnesol biosynthesis (2/4 steps found)
- superpathway of linalool biosynthesis (1/3 steps found)
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
- ipsdienol biosynthesis (1/4 steps found)
- methyl phomopsenoate biosynthesis (1/4 steps found)
- superpathway of chorismate metabolism (40/59 steps found)
- bisabolene biosynthesis (engineered) (2/6 steps found)
- mono-trans, poly-cis decaprenyl phosphate biosynthesis (1/5 steps found)
- superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
- stellatic acid biosynthesis (2/8 steps found)
- viridicatumtoxin biosynthesis (1/9 steps found)
- superpathway of ergosterol biosynthesis II (11/26 steps found)
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
- superpathway of ergosterol biosynthesis I (6/26 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (24/56 steps found)
- superpathway of cholesterol biosynthesis (6/38 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Terpenoid biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.5.1.1 or 2.5.1.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (304 amino acids)
>ABID97_RS09275 polyprenyl synthetase family protein (Variovorax sp. OAS795) MSAAVSDWDAARLAGWSEPHLAHVEAALSRWVGVDAPVLLGDAMRYAVLDGGKRLRPLLV LAASEAVGGNAAAALRAACATELIHAYSLVHDDLPSMDNDVLRRGKPTVHVKFGEADALL AGDALQALAFELLTPEGNEIPAATQALLCRLLARAAGSQGMAGGQAIDLASVGMALDEDQ LREMHRLKTGALLQGSVEMGAACAAAVTPAALNALRDYGAAIGLAFQVVDDILDVTADSQ TLGKTAGKDAAADKPTYVSLWGLDGARAQARQLLAEALAALERSGLADTAALRALAHMVV DRDR