Protein Info for ABID97_RS09260 in Variovorax sp. OAS795

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 43 (17 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 244 to 267 (24 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_1567)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>ABID97_RS09260 DMT family transporter (Variovorax sp. OAS795)
MVLGAFLFATMSVVVKVASAWFNSGEMVLGRGLIGIVFLWLLARNRRVSLVTRYPGMHAW
RSTIGVVSLGAWFYAIAHMPLATAVTLNYMSSVWIAAFLVGGALLAWVPVPGRDGRVERP
PLQGPLVLTVLAGFVGVVLMLKPSVDGHEGFAGLLGLLSGLTAAFAYMQVVALSRIGEPE
LRTVFYFAVGSAVAGAFATAATGFSGGGAWTWQHALWLLPIGLLAALGQLCMTRAYATAK
TQAGTLVVANLQYSGIVFAAFYSVVLFDDRIDAAGWAGMALIIVSGIAATVLRQRAVPKA
PAEEH