Protein Info for ABID97_RS08995 in Variovorax sp. OAS795

Annotation: type VI secretion system protein TssL, long form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 245 to 265 (21 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 59 to 272 (214 residues), 207.3 bits, see alignment E=2.4e-65 PF09850: DotU" amino acids 60 to 267 (208 residues), 207.4 bits, see alignment E=2e-65 TIGR03350: type VI secretion system peptidoglycan-associated domain" amino acids 298 to 434 (137 residues), 150.9 bits, see alignment E=2.1e-48 PF00691: OmpA" amino acids 330 to 428 (99 residues), 69.5 bits, see alignment E=2.7e-23

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 75% identity to vpe:Varpa_3271)

Predicted SEED Role

"Outer membrane protein ImpK/VasF, OmpA/MotB domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>ABID97_RS08995 type VI secretion system protein TssL, long form (Variovorax sp. OAS795)
MLETNASGEKPDATEAAPQADAESSFRHTPPLGDLPAGVQLAPEPSTQERLAAIRTAQNP
LLEAAQPLLRALADMPATLDYDGIKVFHNLLAREVLAFQSLGNIAQIRNEHVVAASYSLC
TALDEAANSTPWGGGKGSEAGVWSNQQLAAQFHGDTKGGDKFFLLVGRIAASPQEHTDLL
ELMYQILGLGFEGRYSTAKDGRRQLETIRHRLLALLASARGEVPTDLSPHWKGAGAEKSS
LLRSLPVWVTASVLALVLVGLFAWYKYQLLSASADVEQRIAAIGRLRAPPSPAAKPLRLK
ELLSAEIARGTVRVEEDDHQSAVTFKGDDMFVPGQARLNPKILPVLAKVADEINQVTGTV
RITGHSDNQPIKTREFPNNQVLSEKRAAAAAQILQDKGVAASRMKVEGRGDTAPLDDGKT
AAARARNRRVDIVVTQGGVTSAPAAHAAGR