Protein Info for ABID97_RS08905 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 41 to 76 (36 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 249 to 273 (25 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 34 to 303 (270 residues), 98.2 bits, see alignment E=7.1e-32 PF00005: ABC_tran" amino acids 367 to 526 (160 residues), 97.9 bits, see alignment E=1.2e-31 PF12399: BCA_ABC_TP_C" amino acids 575 to 597 (23 residues), 32.7 bits, see alignment (E = 6.9e-12)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein K01998, branched-chain amino acid transport system permease protein (inferred from 97% identity to vap:Vapar_1506)

Predicted SEED Role

"Branched-chain amino acid ABC tranpsorter, permease/ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (599 amino acids)

>ABID97_RS08905 branched-chain amino acid ABC transporter ATP-binding protein/permease (Variovorax sp. OAS795)
MNDNNNIDRKRMAWIAAVVAVLALVPAVAGSFTVSLLNDIGIGALVALGLVLLTGVGGAT
SFGQAAFVGIAAYATAWLTTTQGMSPWIGLLFALLLTGLSALAIGMLTLRLGGHFLPLST
IAWGLSIAMLFGNVDALGRHTGLSNIPALRIAGWSLADPRSMYYLIWAVVGLACLFSHNL
LQSRPGRAIRGLRGGATLLASVGADAYRVRLTLFVTAALFAGLAGWLYAHMNRFVSPSPF
DVRASIEYLLMAVAGGLGQLAGALVGAALVLVLKNGLQDVLPMLTQRAGQLEAVAFAALF
ILLLHFARGGLMGLLRRWTRRRAGVPGASRYQPPAVDPLPHRQLPERGTQVLSVKGAVKR
FGGLVAVNDVSFEVNAGEIVGLIGPNGAGKSTMFNLLTCTLPMTSGQVRFLAHDIAGMPQ
RQVARLGLARTFQHVKLRPHMSLLDNVALGAHSRTRSGILKAGLRLDRTEERQILQEAQR
QLDRIGLGDRAHELAGSLPLGTQRILEIARALAADPVLLVLDEPAAGLRRKEKMALGDLL
RKLREEGVTILIVEHDMDFVMKLVDRLVVMNFGSKLVEGAPAAVRADERVQAAYLGSVV