Protein Info for ABID97_RS08775 in Variovorax sp. OAS795

Annotation: ribosome small subunit-dependent GTPase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00157: ribosome small subunit-dependent GTPase A
  • amino acids 53 to 308 (256 residues), 173.6 bits, E=2.6e-55
• PF03193: RsgA_GTPase
  • amino acids 72 to 247 (176 residues), 146.8 bits, E=6.1e-47

Best Hits

Swiss-Prot: 91% identical to RSGA_VARPS: Small ribosomal subunit biogenesis GTPase RsgA (rsgA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 91% identity to vap:Vapar_1480)

Predicted SEED Role

"Ribosome small subunit-stimulated GTPase EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (317 amino acids)

>ABID97_RS08775 ribosome small subunit-dependent GTPase A (Variovorax sp. OAS795)
MAKPGRAAASPAPAAKALHDGLVVASHGRHCLVETPAGERLICHPRGKKSQAVVGDRVRW
QATEDEGTIEAVLPRRNLFYRQDEIRTKSFAANLDHVLILIAAEPEFSEHQLARALIAAE
AERITPIIALNKSDLVEPFGRAWNKLAPYRRMHHGVLPLSLKASGEADYASLMKLLAGKS
TLVLGPSGSGKSTLTNLLVPGATVLTQEISQALNSGKHTTTSTTWYWIDEARTTGLIDSP
GFQEFGLNHIQPMQLARLMPDIAEHANDCKFYNCTHLHEPGCGVIANVDSPARPGPISAS
RYRIYGELFAELSQSRY