Protein Info for ABID97_RS08650 in Variovorax sp. OAS795

Annotation: murein biosynthesis integral membrane protein MurJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details amino acids 415 to 436 (22 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details amino acids 488 to 509 (22 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 2 to 510 (509 residues), 422.3 bits, see alignment E=1.3e-130 PF03023: MurJ" amino acids 28 to 472 (445 residues), 395.8 bits, see alignment E=2.4e-122 PF13440: Polysacc_synt_3" amino acids 237 to 344 (108 residues), 29.7 bits, see alignment E=4e-11

Best Hits

Swiss-Prot: 52% identical to MURJ_BURCJ: Lipid II flippase MurJ (murJ) from Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)

KEGG orthology group: K03980, virulence factor (inferred from 93% identity to vap:Vapar_1455)

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>ABID97_RS08650 murein biosynthesis integral membrane protein MurJ (Variovorax sp. OAS795)
MSLLKSASTVSLLTLASRITGLVRDVLFASVFGVSALTDAFNVAFRIPNLFRRVFGEGAF
SQAFVPVLAARKTEAGEEGAKALIDHVATLLTWALVVLCVAGVLGAPWLVWAMASGLAGF
DAAVVMTRWMFPYIGFMSLVALAGGVLNTWRKFAVPAASPVLLNLSLILAIVAGAPLFRR
YGIEPIYAQCAGVLVGGVLQLALQVPALRALGLMPRIGASWKALRAAWADPTTRKVLKLM
LPALLGVSVAQISLLINTQIASHLAVGSVTWVSNADRLMEFPTAMLGVALGVVLMPQLAG
ARAAKDDARYSSLLDWGLRLVILLSAPCAVALLLFAQPLVAVLFHNGAYQGEDVRRTTVA
LMGYGVGLVGLVAVKVLAPGYYARQDTRTPMLIAIGVLVLTQVLNFFLVPLLQHAALTLT
IAIGALVNAVWLLVGLIRRGSYRPEPGWGKFVLQVLAGALVLAALLAWGSRHFDWIGLRE
QRFHRIGLLAALIAGAALLYFAVLAAVGVRLRSFMRR