Protein Info for ABID97_RS08630 in Variovorax sp. OAS795

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00658: ornithine carbamoyltransferase
  • amino acids 11 to 307 (297 residues), 373.1 bits, E=4.9e-116
• PF02729: OTCace_N
  • amino acids 11 to 150 (140 residues), 161.5 bits, E=1.6e-51
• PF00185: OTCace
  • amino acids 157 to 305 (149 residues), 181.5 bits, E=1.2e-57

Best Hits

Swiss-Prot: 85% identical to OTC_ACIAC: Ornithine carbamoyltransferase (argF) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: None (inferred from 99% identity to vap:Vapar_1451)

MetaCyc: 50% identical to ArgF (Bacillus subtilis)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-citrulline degradation (3/3 steps found)
• urea cycle (4/5 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.3

Use Curated BLAST to search for 2.1.3.3

Protein Sequence (311 amino acids)

>ABID97_RS08630 ornithine carbamoyltransferase (Variovorax sp. OAS795)
MTTATTPHAIRHYLQFSDFTADEYAYLFERMAIIKKKFKTYEKHQPLTDRTLAMIFEKAS
TRTRVSFEAGMYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTYEQTKIDT
FAAHSRVPVINGLTNEFHPCQILADIFTYIEHRGSIQGKTVAWVGDGNNMANTWLQASEI
LGFKVHVSTPSGYEVDQSVAGLRSADSYQVFKDPMEACRGADLVTTDVWTSMGYESENEA
RRKAFADWCVDEDMMRIAQPDALFMHCLPAHRGEEVQAEVIDGPQSVVWDEAENRLHAQK
ALMEFLLLGRL