Protein Info for ABID97_RS08515 in Variovorax sp. OAS795

Annotation: malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01759: malate dehydrogenase" amino acids 3 to 322 (320 residues), 476.3 bits, see alignment E=2.1e-147 PF00056: Ldh_1_N" amino acids 6 to 155 (150 residues), 120.6 bits, see alignment E=5.6e-39 PF02866: Ldh_1_C" amino acids 160 to 321 (162 residues), 135.8 bits, see alignment E=1.7e-43

Best Hits

Swiss-Prot: 99% identical to MDH_VARPS: Malate dehydrogenase (mdh) from Variovorax paradoxus (strain S110)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 99% identity to vap:Vapar_1432)

MetaCyc: 60% identical to malate dehydrogenase (Mycobacterium tuberculosis H37Rv)
Malate dehydrogenase. [EC: 1.1.1.37, 1.1.1.38]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.37 or 1.1.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>ABID97_RS08515 malate dehydrogenase (Variovorax sp. OAS795)
MSKKPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKGVMMEL
DDCAFPLLAGMEAHGDPMTAFKDADYALLVGSRPRGPGMERAELLAVNGAIFTAQGKALN
AVASRNVKVLVVGNPANTNAYIAMKSAPDLPRKNFTAMLRLDHNRAASQIAAKTGKPVAD
IEKLVVWGNHSPTMYADYRFATIKGESVAKMINDQEWNANTFLPTVGKRGAAIIEARGLS
SAASAANAAIDHMRDWALGTNGKWVTMGIPSDGQYGIPKDTMFGFPVTCENGEYKLVEGL
EIDAFSQERINKTLEELQGEQAGVAHLV