Protein Info for ABID97_RS08500 in Variovorax sp. OAS795

Annotation: succinate dehydrogenase, hydrophobic membrane anchor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01127: Sdh_cyt
  • amino acids 11 to 109 (99 residues), 45.7 bits, E=3.4e-16
• TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein
  • amino acids 14 to 119 (106 residues), 109.9 bits, E=3.3e-36

Best Hits

Swiss-Prot: 40% identical to DHSD_COXBU: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 98% identity to vap:Vapar_1429)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Protein Sequence (121 amino acids)

>ABID97_RS08500 succinate dehydrogenase, hydrophobic membrane anchor protein (Variovorax sp. OAS795)
MSVNYGAKRIVVGAHYGLRDWLSQRITGGLMALFTIILLAQLIFTRGPIGYDLWAGIFAA
QWMKVLTFSVIVSLLYHVWVGMRDVWMDYVQPVGIRLALQIFTIVWLVGCAGWAIQVLWK
I