Protein Info for ABID97_RS08355 in Variovorax sp. OAS795

Annotation: signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 130 to 141 (12 residues), see Phobius details PF10502: Peptidase_S26" amino acids 97 to 309 (213 residues), 193.9 bits, see alignment E=1e-61 TIGR02227: signal peptidase I" amino acids 102 to 310 (209 residues), 172.4 bits, see alignment E=3.5e-55

Best Hits

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 97% identity to vap:Vapar_1400)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>ABID97_RS08355 signal peptidase I (Variovorax sp. OAS795)
MAFITTLVLAAFASYVGAWYFGAIEGNFALLLFLATVVTGLYWLAERFYFMPRRERAAAA
LETSLSERNARLAGQGITQVDTVDAKASERLLMQPWWLDWTAGLFPVILVVFLLRSFLYE
PFKIPSGSMMPTLLTGDLILVNKFTYGLRLPVINTKITDGTPLARGDVVVFRYPPKPSMD
YIKRVVGIPGDEVAYLNKKLTINGQPVSKTPMPDYLDNDSMRLLKQFNEDLGGKQHRLLN
DDAGPAFVQGASDFPFRDNCRYSVEGVVCKVPAGNYFMMGDNRDNSADSRFWGFVPDKNI
VGRAFFVWMNFGDLGRIGPFQ