Protein Info for ABID97_RS08330 in Variovorax sp. OAS795

Annotation: RNA polymerase sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR02939: RNA polymerase sigma factor RpoE" amino acids 25 to 216 (192 residues), 261.7 bits, see alignment E=4.5e-82 PF07638: Sigma70_ECF" amino acids 30 to 209 (180 residues), 31.4 bits, see alignment E=4.4e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 42 to 209 (168 residues), 97.8 bits, see alignment E=5.2e-32 PF04542: Sigma70_r2" amino acids 46 to 109 (64 residues), 58.3 bits, see alignment E=1.3e-19 PF08281: Sigma70_r4_2" amino acids 158 to 207 (50 residues), 69.4 bits, see alignment E=4.2e-23 PF04545: Sigma70_r4" amino acids 161 to 208 (48 residues), 41.8 bits, see alignment 1.6e-14

Best Hits

Swiss-Prot: 53% identical to RPOE_SALTI: ECF RNA polymerase sigma-E factor (rpoE) from Salmonella typhi

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 97% identity to vap:Vapar_1395)

MetaCyc: 53% identical to RNA polymerase sigma factor RpoE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>ABID97_RS08330 RNA polymerase sigma factor RpoE (Variovorax sp. OAS795)
MTTSPPPVPPDSGLPDASVEAPRPGEVDLQLVQRTVAGDQKAFELLVIKYQRRIERLIGR
MVRDVDLVEDIAQETFIRAYRALHQFRGDAQFYTWLYRIAVNTAKKALVDMKRDPTISES
AMRPSSDEDDETYRPGNEPISDETPESILAANEIARVVEAAMEALPSELRQAVTLREIEG
MSYEEIAEVMDCPIGTVRSRIFRAREAISARVKPLLDNQSGKRW