Protein Info for ABID97_RS08280 in Variovorax sp. OAS795

Annotation: Maf family nucleotide pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 TIGR00172: septum formation protein Maf" amino acids 1 to 186 (186 residues), 158.2 bits, see alignment E=8.4e-51 PF02545: Maf" amino acids 4 to 187 (184 residues), 176.7 bits, see alignment E=2e-56

Best Hits

Swiss-Prot: 72% identical to NTPPB_RHOFT: 7-methyl-GTP pyrophosphatase (Rfer_1726) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K06287, septum formation protein (inferred from 94% identity to vap:Vapar_1385)

MetaCyc: 51% identical to m7GTP pyrophosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-7079

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>ABID97_RS08280 Maf family nucleotide pyrophosphatase (Variovorax sp. OAS795)
MQRPLILASTSRYRRELLMRLRLPFDVQPPEVDETARSGETPRELAERLALEKAQAVAAR
FPEAVVIGSDQVADLAGEALGKPGDHARATAQLRRMRGQALVFQTAVAVVCQATGFVQRD
LAPVRVVFRELSDAAIEQYLQAEQPYDCAGSAKSEGLGIALLSAIDSDDPTALVGLPLIR
TCRMLRSAGIELL