Protein Info for ABID97_RS08210 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 345 (311 residues), 130.3 bits, see alignment E=1.2e-41 PF00083: Sugar_tr" amino acids 66 to 202 (137 residues), 25.8 bits, see alignment E=7.6e-10 PF06779: MFS_4" amino acids 86 to 396 (311 residues), 27.1 bits, see alignment E=4.1e-10

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_1371)

Predicted SEED Role

"FIG01056426: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>ABID97_RS08210 MFS transporter (Variovorax sp. OAS795)
MNSPSSNPCADDLVHEPAEAARSTRSAWPAVGSIAVGTFAMVSTEFMPIGLLTDIARGLD
VSDGTAGLMITMPGVLAAFAGPALIVASGRLDRRTVLIALTSLLIASNLLAAFAPNFATM
LVARLMLGLCVGGFWTFAPAAATQLVPDASKARAMSLVLAGVSAATVLGVPAGSFLGTLF
GWRASFAVTGALAALVLVVQLWLLPAMPPARAIGARDLLTPLTRRMAQVGLLAVLFFIAG
HFAAYTYLKPLLQQVFGLAPNSVSALLLVYGAVGFIGTFIGGSLVARSVRGTTLLAALML
ATALLLSTVIGSGLVPGAIVVFIWGVAFGLIPVALTGWMMEAVPDAPEAGQALLVSGFQV
AIASGALIGGVTVDSYGISHTMVLSGVLVLIAALIVGTLGRARGGAPALAVTSPE