Protein Info for ABID97_RS08195 in Variovorax sp. OAS795

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 45 to 68 (24 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details PF06580: His_kinase" amino acids 174 to 252 (79 residues), 83.6 bits, see alignment E=4.8e-28

Best Hits

KEGG orthology group: K08082, two-component system, LytT family, sensor histidine kinase AlgZ [EC: 2.7.13.3] (inferred from 93% identity to vap:Vapar_1362)

Predicted SEED Role

"Autolysis histidine kinase LytS" in subsystem Murein hydrolase regulation and cell death

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>ABID97_RS08195 histidine kinase (Variovorax sp. OAS795)
MGWLPNVSLMRNPAILSASSTSTPSAPPERGRLPARGSAGLFDACQIGVVLRTVLFVEAV
VATGTLFVSPSAGEWLVQTATVTGGALPATLLWLVAACGLRKPLGRLPRQAQYVAGAMLG
AVSSLYGCGLLRLTGVVGSAPWVASAVAGGFIAALVMAAMVLRARGQTPAATTARLEELQ
SRIQPHFLFNTLNSAIALVREEPAKAETMLEDLAELFRQALADPGESGTLADEIALAERY
LAIEQVRFGDRLRIRWDLDAAASSARLPPLLLQPLVENAIKHGVEPSPEGAKLRIRTERR
GSVVVIEVVNSLPPLRWADEPLPRGHGIALANVRDRLRLLHDMQMQFSAGMDQKNYRVRI
AIPAEP