Protein Info for ABID97_RS08190 in Variovorax sp. OAS795

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR00838: argininosuccinate lyase" amino acids 13 to 464 (452 residues), 615.8 bits, see alignment E=2.6e-189 PF00206: Lyase_1" amino acids 17 to 309 (293 residues), 254.8 bits, see alignment E=1.3e-79 PF14698: ASL_C2" amino acids 372 to 440 (69 residues), 93.1 bits, see alignment E=1.2e-30

Best Hits

Swiss-Prot: 98% identical to ARLY_VARPS: Argininosuccinate lyase (argH) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 98% identity to vap:Vapar_1361)

MetaCyc: 52% identical to argininosuccinate lyase (Escherichia coli K-12 substr. MG1655)
Argininosuccinate lyase. [EC: 4.3.2.1]

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>ABID97_RS08190 argininosuccinate lyase (Variovorax sp. OAS795)
MTQNQLDKKSEAWSALFSEPMSDLVKRYTASVFFDKRLWQADIEGSLAHAGMLAAQGIIE
KQDHAEIERGMAQIRGEIESGAFEWKLDLEDVHLNIEARLTQLVGDAGKRLHTGRSRNDQ
VATDVRLWLRGEIDLIAELLVALQVSLVDIAEKNVEVILPGFTHLQVAQPVSFGHHMLAY
VEMFSRDAERLQDVRKRVNRLPLGAAALAGTSYPLDRELVARTLKMDGVCQNSLDAVSDR
DFAIEFTAAASLCMVHISRMSEELILWMSQNFGFIQIADRFTTGSSIMPQKKNPDVPELA
RGKTGRVVGHLMALITLMKGQPLAYNKDNQEDKEPLFDTVDTLKDTLRIFAEMIGGITVK
PEAMEAAALRGYATATDLADYLVKKGLPFRDAHETVAHAVKAATSHKVDLAELPLAVLQQ
FNPKIEKDVYDVLSLRGSLNARNILGGTAPAQVKAQITRHRQRLA