Protein Info for ABID97_RS08095 in Variovorax sp. OAS795

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 12 to 13 (2 residues), see Phobius details transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 172 to 198 (27 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 14 to 262 (249 residues), 230.5 bits, see alignment E=1.1e-72 PF00528: BPD_transp_1" amino acids 101 to 260 (160 residues), 48.3 bits, see alignment E=5.3e-17

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 80% identity to vpe:Varpa_4730)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE1 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>ABID97_RS08095 phosphonate ABC transporter, permease protein PhnE (Variovorax sp. OAS795)
MNARMKLAGPPRCIRCWIASALVLAGVAASFAYLAIDYRALFTAESIGLMGKFVAEFFPP
DLSSAFLAKTAWGALQTLAVSALGTLLAAVGAALLALPASGRSGLLLRQACRFVLNFLRS
VPELVWAALMVLAAGIGPFAGALALALHTTGVLGRLFAESLENAPREPEQALALGGAGAV
AAFGYGSLPLVLPQWVAYALYRWEMNIRMAAVLGFVGGGGLGQLLYFHLSIFQQQQAMTV
LIAMFVLVAVVDLASGRLRRNLGHAHA