Protein Info for ABID97_RS08010 in Variovorax sp. OAS795

Annotation: alpha-hydroxy acid oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF01070: FMN_dh" amino acids 17 to 379 (363 residues), 454.2 bits, see alignment E=2.9e-140 PF03060: NMO" amino acids 248 to 340 (93 residues), 28.4 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 46% identical to LLDD_PSEU2: L-lactate dehydrogenase (lldD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 96% identity to vap:Vapar_1331)

MetaCyc: 44% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>ABID97_RS08010 alpha-hydroxy acid oxidase (Variovorax sp. OAS795)
MPDLSKITCIEDLRVVAKRRVPRMFYDYADSGAWTESTYRANESDFQKIKLRQRVAVNME
GRSTRTTMIGQDVAMPVAIAPTGLTGMQHADGEILGARAAKAFGIPFTLSTMSICSLEDI
AEHTGRHPFWFQLYVMKDRDFIERLIERARAANVSALQLTLDLQILGQRHKDIKNGLSTP
PKPTIANMINLATKPHWCLGMLGTRRRTFGNIAGHAKGVKDLSSLSSWTAEQFDPALSWA
DVEWIKKRWGGKLILKGIMDAEDARLAAASGADALIVSNHGGRQLDGAPSSISALPAIVE
AVGRDIEVWMDGGIRSGQDVLKARALGARGTLIGRSFLYGLGAYGQAGVTRALQLIHKEL
DITMAFCGHTDIENVDSGILLPGTF