Protein Info for ABID97_RS07895 in Variovorax sp. OAS795

Annotation: UTP--glucose-1-phosphate uridylyltransferase GalU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01099: UTP--glucose-1-phosphate uridylyltransferase
  • amino acids 8 to 272 (265 residues), 366.3 bits, E=4.8e-114
• PF00483: NTP_transferase
  • amino acids 15 to 276 (262 residues), 97.8 bits, E=3.9e-32

Best Hits

Swiss-Prot: 52% identical to GALU2_PSEAI: UTP--glucose-1-phosphate uridylyltransferase (galU) from Pseudomonas aeruginosa

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 98% identity to vap:Vapar_1299)

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose biosynthesis II (6/8 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• stachyose degradation (2/7 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.9

Protein Sequence (296 amino acids)

>ABID97_RS07895 UTP--glucose-1-phosphate uridylyltransferase GalU (Variovorax sp. OAS795)
MPTPSTRIRKAVFPVAGFGTRFLPATKAQPKEMLPVVDKPLIQYAVEEAYAAGIRDMIFV
TGRNKRAIEDHYDTAYELESQLEANGKLELLDIARSVMPDDMTCSYVRQPRMLGLGHAVL
CAEHLVGNEPFAVLLADDLMVGPVGGLPVLAQMTAAFGKLGASVLAVQEVPLEHVKRYGI
VAGESIGDDLVKVDRMIEKPSPDKAPSRLGVAGRYILTPGVFEEIRNQPKGAGGEIQLTD
GIAALMKKEAVYAYAYKGIRYDCGSKEGFLQASVELALAHPEVGAQFREYLKSLEL