Protein Info for ABID97_RS07840 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 38 to 39 (2 residues), see Phobius details amino acids 41 to 54 (14 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 236 to 260 (25 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 293 (286 residues), 159.9 bits, see alignment E=3.7e-51

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 99% identity to vap:Vapar_2105)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ABID97_RS07840 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MEILLQQIINGLVLGSMYALIALGYTMVYGIINLINFAHGEVLMVGALTSWSIIGLMKES
MPGTPGWLILIIALIIACVVAATLNFVIEKVAYRPLRNSPKLAPLITAIGMSILLQTLAM
IIWKPTNKAYPNLLSTTPIEVGGAVISPTQVMILSVTAFSLVVLMWLVNYTKLGRAMRAT
AENPRVAALMGIRPDMVISATFIIGAVLAAIAGVMYASNYGIAQHAMGFLPGLKAFTAAV
FGGIGNLAGAVVGGILLGLIEAIGSGYIGSLTGGVLGSNYSDIFAFIVLIVMLTLRPSGL
LGERVADRA