Protein Info for ABID97_RS07835 in Variovorax sp. OAS795

Annotation: replication-associated recombination protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF05496: RuvB_N" amino acids 13 to 126 (114 residues), 37.9 bits, see alignment E=5.4e-13 PF07728: AAA_5" amino acids 46 to 124 (79 residues), 22.1 bits, see alignment E=4.8e-08 PF00004: AAA" amino acids 47 to 157 (111 residues), 56.5 bits, see alignment E=1.4e-18 PF16193: AAA_assoc_2" amino acids 180 to 254 (75 residues), 85 bits, see alignment E=1.3e-27 PF12002: MgsA_C" amino acids 255 to 421 (167 residues), 231.5 bits, see alignment E=1.9e-72

Best Hits

Swiss-Prot: 55% identical to RARA_ECO57: Replication-associated recombination protein A (rarA) from Escherichia coli O157:H7

KEGG orthology group: K07478, putative ATPase (inferred from 97% identity to vap:Vapar_1287)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>ABID97_RS07835 replication-associated recombination protein A (Variovorax sp. OAS795)
MATSSHQPLAERLRPKTLGEVIGQQHLLGPGMPLRIAFESGQPHSCILWGPPGTGKTTIA
RLMADAFDAQFLSISAVLGGVKDIREAVERATSARDGLEQQRTIVFVDEVHRFNKSQQDA
FLPHVESGLFTFIGATTENPSFEVNSALLSRAAVYVLQPLTEADLKQIVAKAQGIQAVPA
IEESAIDRLVAYADGDARRLLNTLETLAVAAKAEKLGNITDEWLLRVLGERMRRYDKGGE
QFYDTISALHKSVRGSDPDASLYWFVRMLDGGADPRYMARRLVRMASEDIGLADPRALRL
ALDAAEVYERLGTPEGELALAECVVYLAMAPKSNAVYKAYNAVRALIKKDSTRPVPMHLR
NAPTKLMKELDYGKGYRYAHDEEGGFAAGERYLPEGLEGQVFYQPVERGLEIRIAEKLRE
LRRLNGQREE