Protein Info for ABID97_RS07830 in Variovorax sp. OAS795

Annotation: outer membrane lipoprotein chaperone LolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR00547: outer membrane lipoprotein carrier protein LolA" amino acids 8 to 208 (201 residues), 66.3 bits, see alignment E=1.3e-22 PF03548: LolA" amino acids 31 to 200 (170 residues), 145.3 bits, see alignment E=1.5e-46

Best Hits

Swiss-Prot: 72% identical to LOLA_RHOFT: Outer-membrane lipoprotein carrier protein (lolA) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 96% identity to vap:Vapar_1286)

Predicted SEED Role

"Outer membrane lipoprotein carrier protein LolA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>ABID97_RS07830 outer membrane lipoprotein chaperone LolA (Variovorax sp. OAS795)
MKIRHWLLIGLLSSANAWAGGLESLETFVKTVKSGRAEFTQTVTAPPREGQPGRTKVSNG
TFEFQRPGKFKFDYQKPFAQTIVADGKTLWLYDADLNQVTQRAQSQALGSTPAALIAAAP
DLRALQADFTLEAAPERDGLQWVKATPKNKDGQLQNVQVGFQGDALAALEILDSFGQRSV
LKFSKVEVNPALAATVFDFKAPAGADVIKQ