Protein Info for ABID97_RS07790 in Variovorax sp. OAS795

Annotation: M48 family metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details PF01435: Peptidase_M48" amino acids 155 to 331 (177 residues), 45.5 bits, see alignment E=4.1e-16

Best Hits

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_1278)

Predicted SEED Role

"FIG00933533: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (617 amino acids)

>ABID97_RS07790 M48 family metalloprotease (Variovorax sp. OAS795)
MDRADFVHLVRLSEHASADDSARYRRNVAAFAALGYLWVMACLALSVGIIAWVALAAGRG
RFGFSRGWLLLFALGLLWATLRALWVRFDEPDGRELSRADAPALFEALDRIRRKIKGPPV
HRVFLDDEFNASIRQVPRFGLFGGAVNSLSIGLPLLMMLDRRRLLSVLAHEYGHLRGNHG
KLSAWIYRTRLSWLKLDASLQREEGVMALVSQAFFRWYFPRFAARTFALARQDEYEADRI
SGRLLGAPVAAAALTEIAIKGNWYANEFWASHWARAEREPQPPGPFKALQALAGTSPGDE
FARQALREAMRRVSDLDDTHPVLRDRLEALGQKAVVPPWSTEPALGMLADSTKWIAHFDN
QWRRSHAADWKQHHAHRTRIRERIELLAAQGERNTPDEMVEWADSERRLDPAAPVRDRYE
RVLRISPDHPGALRGVAQMLPARERDARLALLERLHGCSAASRWWAAKDAVAALEDPEAG
VHDEEALRLWRGRLKEAEEAEARAWEEITETPFFSQIVRHDLNDHELGELRADLSRCLPI
SRAWVVRKTLREFPWRRAYIVFVDLPGMDDDDRWQLCRQLEHTLGLPGAALVLWAGHSPT
LDDIERQAFGTIWTRTA