Protein Info for ABID97_RS07700 in Variovorax sp. OAS795

Annotation: DNA repair protein RadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF20582: UPF0758_N" amino acids 4 to 75 (72 residues), 86.5 bits, see alignment E=1e-28 TIGR00608: DNA repair protein RadC" amino acids 11 to 225 (215 residues), 226.5 bits, see alignment E=1.7e-71 PF04002: RadC" amino acids 105 to 224 (120 residues), 148.7 bits, see alignment E=7.2e-48

Best Hits

Swiss-Prot: 95% identical to Y4033_VARPS: UPF0758 protein Vapar_4033 (Vapar_4033) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 95% identity to vap:Vapar_4033)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>ABID97_RS07700 DNA repair protein RadC (Variovorax sp. OAS795)
MAFKDLPAHARPREKLIARGAGALADAELLALLLRTGVAGKNVLQLAQELLEHFGGLSGL
LQTSPEDLKVIKGMGGDAKRAELIAVLELARRAMAERLKERTVFDSPGAVKEYLQMHIGS
RPYEVFAVLFLDAQHRLIVLEELFRGTLTQTSVYPREVVTRALHHHAAAVVLSHNHPSGS
IEPSRADESLTQTLRAALALVDVRVLDHVIVSTGQALSMAEKGLL