Protein Info for ABID97_RS07670 in Variovorax sp. OAS795

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 24 to 49 (26 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 23 to 116 (94 residues), 92.7 bits, see alignment E=8.3e-31 PF00528: BPD_transp_1" amino acids 39 to 223 (185 residues), 82.8 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 36% identical to ARTQ_BACSU: Arginine transport system permease protein ArtQ (artQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 95% identity to vap:Vapar_4040)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>ABID97_RS07670 amino acid ABC transporter permease (Variovorax sp. OAS795)
MLEIINDYWVYFLIGQYPNGPLGGLVLTLLLASCGLVLALPLGIVLGLARVSPWRWLRWP
VTGFVFVVRGLPLLMVIFWAYFFLPSITGVKTDQFTTMLIALVVFDAAYLAEIVRAGIQG
LPRGQMETARALGLGYGRAMRLVVLPQALRSMLPSLVNQFVSTIKETSLGYIIGLAEVSF
IATQINTQVFTRPAQIYLILGLTYFILCFGLSRFAYWLERRLARRGIAVTHPASAPKVPA