Protein Info for ABID97_RS07640 in Variovorax sp. OAS795

Annotation: ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 40 to 64 (25 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 15 to 244 (230 residues), 356.6 bits, see alignment E=2.3e-111 PF00116: COX2" amino acids 156 to 224 (69 residues), 28.4 bits, see alignment E=1.3e-10 PF06481: COX_ARM" amino acids 249 to 288 (40 residues), 57.2 bits, see alignment 1.2e-19

Best Hits

Swiss-Prot: 51% identical to CYOA_PSEAE: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 91% identity to vap:Vapar_4046)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>ABID97_RS07640 ubiquinol oxidase subunit II (Variovorax sp. OAS795)
MPTLKSLRRWPLLLPLALLAGCNTVLMNPSGDIANQQGRLIVVSTVLMLIIIVPVIALTI
FFAWRYRQSNKEADYSPDWDHSTQLELAIWAAPLLIIIALGAITWISTHTLDPYRPLSRL
DADRAVPAEAKPLVVEVVALDWKWLFIYPEQGFATVNEMAAPVDRPITFKITATSVMNSF
FIPALAGQIYAMPGMETKLHAVINKPGEFEGFSANYSGAGFSGMRFKFHGLSNEGFDEWV
KKAKAGKDGELSRETYLKLEAPSERDPVRHYARVAPDLYDAILNRCVDRNKMCMKQMMAI
DAEGGLGKPGAFNVASKAAGWQPDSLNSSSPTRKYVTAMCTTEE