Protein Info for ABID97_RS07615 in Variovorax sp. OAS795

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details PF02518: HATPase_c" amino acids 336 to 437 (102 residues), 60.8 bits, see alignment E=8.4e-21

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 94% identity to vap:Vapar_4051)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>ABID97_RS07615 ATP-binding protein (Variovorax sp. OAS795)
MPTATEPAAVAGELHAPRAGVASLDNATGHKNMQQLIQLRWFAVVGQVATILLVHYGFGI
RLPLDHMLQVLTCLALFNGVSLLRSRSVRRVTNGELFLALLVDVATLTAQLYLSGGATNP
FVFLYLLQVILGAVLLKAWSTWTIVIVTSLCFAGLALFSRPLALPLDHDRGLWSPYVQGM
LICFALNAALLVVFITRISRNLRARDARLADLRQRASEEEHIVRMGLLASGAAHELGTPL
ATLAVILGDWRRLPHFSSDPELLTEVAEMELQIQRCKSIVSGILLSAGEARGESSEETTV
RTFLDELVEEWRATRPVEEFDYENRFGQDLPMVSDSALKQMICNVLDNALEASPHWLRLE
VAHDAEALTLTVTDAGPGFLPSILKEFGKPYQSSKGRPGGGLGLFLVVNVARTLGGRVAV
HNRLEGGAIVRITLPLAAIVLEEEDDDEAGDEAPAIDAITDTKAHDANR